Protein coding transcript 861

• Transcript: Ll_transcript_435607
• CDS coordinates: 2-580 (+)
• Peptide sequence: IKHTETYVINARNFLSCEESQYHSFKNIPRDEMMQETTILGWLSSMTVPKDAHKVMVAKILDCARRMTLNKDKKVLYMRVDINITIATEDCDYSDDDNDDSDSDDDNDEDEEHRFVPASNSSIEELETINEQEGCVNCGKCAICFEDINVVSVQMPCLHKFHKNCIVDWLKISGFCPLCRFPMPSEEGEKEC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_435607

• Blastp: E3 ubiquitin-protein ligase SIRP1 from Oryza sativa with 43.84% of identity
• Blastx: E3 ubiquitin-protein ligase SIRP1 from Oryza sativa with 43.84% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (4339152)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439005.1)
• Pfam: Anaphase-promoting complex subunit 11 RING-H2 finger (PF12861.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;