Protein coding transcript 86103

• Transcript: Ll_transcript_496924
• CDS coordinates: 262-1137 (+)
• Peptide sequence: MKKVRRKIGKYEVGRTIGEGTFAKVKFAKNTETGESVAIKVMAKRTILKHKMVEQIKREISIMKIVRHPNIVRLHEVLASQSKIYIILEFVMGGELYDKIVQLGKVSDNESRRYFQQLIDAVAHCHRKGVYHRDLKPENLLLDDYGNLKVSDFGLSALTKKGVGLLHTTCGTPNYVAPEVLSNLGYDGAAADVWSCGVILYVLMAGYLPFQEADLPMLYKRISAAEFVCPVWFSTGAKTLIHKILDPNPKTRIKIEEIRKDPWFRRSYVPVNPREDEEVNLDDVQAVFNDD*
• ORF Type: complete

Annotations of Ll_transcript_496924

• Blastp: CBL-interacting serine/threonine-protein kinase 24 from Arabidopsis with 75.78% of identity
• Blastx: CBL-interacting serine/threonine-protein kinase 24 from Arabidopsis with 75.78% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G35410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440196.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;