Transcript | Ll_transcript_496924 |
---|---|
CDS coordinates | 262-1137 (+) |
Peptide sequence | MKKVRRKIGKYEVGRTIGEGTFAKVKFAKNTETGESVAIKVMAKRTILKHKMVEQIKREISIMKIVRHPNIVRLHEVLASQSKIYIILEFVMGGELYDKIVQLGKVSDNESRRYFQQLIDAVAHCHRKGVYHRDLKPENLLLDDYGNLKVSDFGLSALTKKGVGLLHTTCGTPNYVAPEVLSNLGYDGAAADVWSCGVILYVLMAGYLPFQEADLPMLYKRISAAEFVCPVWFSTGAKTLIHKILDPNPKTRIKIEEIRKDPWFRRSYVPVNPREDEEVNLDDVQAVFNDD* |
ORF Type | complete |
Blastp | CBL-interacting serine/threonine-protein kinase 24 from Arabidopsis with 75.78% of identity |
---|---|
Blastx | CBL-interacting serine/threonine-protein kinase 24 from Arabidopsis with 75.78% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT5G35410) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440196.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer