Protein coding transcript 86119

• Transcript: Ll_transcript_499015
• CDS coordinates: 27-662 (+)
• Peptide sequence: MGFKLLSLTSLSLSPFPLFTPPFLLSTIPSSLSKSTPGAVTSLTTTRCVNNEKEEVLLPGMPKEYYDDEWQAKQRERTKELRQRQREEDEEEERKIEEYREVGMRLKGYPEEDVRNARKLVSSFIRAEEEIEQKIEEAAEKGILTELVLMVIWNRLDLARRDNEKDAIRSLDLLYRRVEVTTTPFIRSSSIHFSENFIPNSQHMHKEEEKY*
• ORF Type: complete

Annotations of Ll_transcript_499015

• Blastp: Protein PALE CRESS, chloroplastic from Arabidopsis with 66.48% of identity
• Blastx: Protein PALE CRESS, chloroplastic from Arabidopsis with 79.7% of identity
• Eggnog: NA(ENOG4111FTZ)
• Kegg: Link to kegg annotations (AT2G48120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452673.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;