Protein coding transcript 86162

• Transcript: Ll_transcript_496838
• CDS coordinates: 1381-2388 (+)
• Peptide sequence: MHGFTCGVDDLLITEEKDGERMAQLESCEEIGDIVHREFVGVMDNARLDPITLQLNIEKKIRSNGEAALTYLDRKMISNLNTRTSSGILKELLSEGILKSSGKNWISLMTTSGAKGSMVNFQQISSHLGQQELEGKRVPRMVSGKTLPCFTPWDCSPRAGGFIIDRFLTALRPQEYYFHCMAGREGLVDTAVKTSRSGYLQRCLMKNLECLKVSYDHTVRDSDGSVIQFHYGEDGVDVHQTSFITKFEALSTNKELVNSNFCRQLDKSSPYINKLPDALERKAKKFIREKQRNTGSIKRSDFLKLMEHKYISSLAQPGEPVGVLASQSVGEPATQM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_496838

• Blastp: DNA-directed RNA polymerase I subunit 1 from Arabidopsis with 61.88% of identity
• Blastx: DNA-directed RNA polymerase I subunit 1 from Arabidopsis with 57.85% of identity
• Eggnog: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (By similarity)(COG0086)
• Kegg: Link to kegg annotations (AT3G57660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421167.1)
• Pfam: RNA polymerase Rpb1, domain 4 (PF05000.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;