Transcript | Ll_transcript_488635 |
---|---|
CDS coordinates | 111-905 (+) |
Peptide sequence | MNKKTKFLLTVLYSHSYIFLFSLLTITTLCSVEPKFEACQPKTCGNNQSISYPFYIDGIQEPFCGYPGFALSCGNNGFPILNLSNTSYFVDQIFYNNQTLRVSNTMISRSSTTNNKGCLPLTQNLTLPKNNQFILAPNQKEVILFFGCNLSLGPTWLQEHRIRCYEASSVLALYKDDKNISFVSGNCKGGGVADLMVENGDGDEKGNIEEVLRNGFLLNWTASDCSLCRNTGGRCGFDSDMYLFRCYCADRVHAWKCDTLPVPG* |
ORF Type | complete |
Blastp | LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.2 from Arabidopsis with 33.06% of identity |
---|---|
Blastx | LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.2 from Arabidopsis with 33.04% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT1G18390) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441427.1) |
Pfam | Wall-associated receptor kinase galacturonan-binding (PF13947.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer