Protein coding transcript 86309

• Transcript: Ll_transcript_488638
• CDS coordinates: 1127-1597 (+)
• Peptide sequence: MKLLIVATAASLAGVAVLIILAYRFRTKIFLPTYLLFRKSNPTNLIIEKFLKEHGDLPTARYSYSEVKKMTNSFINRVGQGGFGCVYKGKLQDGRDVAVKVLTESKADGEEFINEVASISRTSHVNIVRLLGFSLNGSKRALIYEFMPNGSLEKFI*
• ORF Type: complete

Annotations of Ll_transcript_488638

• Blastp: Rust resistance kinase Lr10 from Triticum with 51.63% of identity
• Blastx: Rust resistance kinase Lr10 from Triticum with 52.41% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441416.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;