Protein coding transcript 86319

• Transcript: Ll_transcript_488623
• CDS coordinates: 3074-3979 (+)
• Peptide sequence: MNEVQILTRLRHTNLVSLYGCTSKHSHELLLVYEYISNGTVACHLHGGLAKPGLLPWSIRMKIAIETAAALAYLHASDIIHRDVKTNNILLTKNFCVKVADFGLSRQFPTHVTHVSTAPQGTPGYVDPEYHQCYQLTSKSDVYSFGVVLIELISSKPAVDINRSKEEINLSNLAIKKIQESAISELVDPSLCFASDNEVKRKIVSVAELAFQCLQSDKEFRPSMDEVLNELTKIQAGNDEQEVAQEAYAPVAGDSLSIVHTRSTSPEWDEVGLLKNMKQPSSPNTVTDKWESKCTTPNVSG*
• ORF Type: complete

Annotations of Ll_transcript_488623

• Blastp: LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.1 from Arabidopsis with 64.78% of identity
• Blastx: LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.1 from Arabidopsis with 63.2% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G25390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441415.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;