Protein coding transcript 86361

• Transcript: Ll_transcript_490977
• CDS coordinates: 1053-1556 (+)
• Peptide sequence: MFSIENSGLAMWLTALVLQVIEIAKGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTICEDSDPLDVLVIMQEPVLPGCFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASTAFEAIKHSM*
• ORF Type: complete

Annotations of Ll_transcript_490977

• Blastp: Soluble inorganic pyrophosphatase 4 from Arabidopsis with 89.86% of identity
• Blastx: Soluble inorganic pyrophosphatase 4 from Arabidopsis with 89.86% of identity
• Eggnog: Pyrophosphate phospho-hydrolase(COG0221)
• Kegg: Link to kegg annotations (AT3G53620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426341.1)
• Pfam: Inorganic pyrophosphatase (PF00719.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;