Transcript | Ll_transcript_490978 |
---|---|
CDS coordinates | 507-887 (+) |
Peptide sequence | MRILCILFNLFGENSYMLFLLRCVMLLCFFPLIGSYFLDDAGPGAPQTFNCVIEIAKGSKVKYELDKKTGLIKVIMAGLLSYFHFCCCLYDTLLYMDLVFLYRLIVYFTHPLCIPTTMALSHVLFVR |
ORF Type | 3prime_partial |
Blastp | Soluble inorganic pyrophosphatase 1 from Arabidopsis with 87.88% of identity |
---|---|
Blastx | Soluble inorganic pyrophosphatase 1 from Arabidopsis with 87.88% of identity |
Eggnog | Pyrophosphate phospho-hydrolase(COG0221) |
Kegg | Link to kegg annotations (AT1G01050) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426340.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer