Transcript | Ll_transcript_490992 |
---|---|
CDS coordinates | 526-1200 (+) |
Peptide sequence | MSEIVVDTELDGEIGAKVVPLIAGRNKSANVVPAIETANKVPTYDYSSHPPLNERIISSMIRRSTAAHPWHDLEIGPGAPQTFNCVIEIAKGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTICEDSDPLDVLVIMQEPVLPGCFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEECILINLSISIADIIYIGIF* |
ORF Type | complete |
Blastp | Soluble inorganic pyrophosphatase 4 from Arabidopsis with 81.71% of identity |
---|---|
Blastx | Soluble inorganic pyrophosphatase 4 from Arabidopsis with 68.75% of identity |
Eggnog | Pyrophosphate phospho-hydrolase(COG0221) |
Kegg | Link to kegg annotations (AT3G53620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426341.1) |
Pfam | Inorganic pyrophosphatase (PF00719.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer