Protein coding transcript 86379

• Transcript: Ll_transcript_490974
• CDS coordinates: 1070-1375 (+)
• Peptide sequence: MFSIENSGLAMWLTALVLQVIEIAKGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTICEDSDPLDVLVIMQEPVLPGCFLRAKAIGLMPMIDQVY*
• ORF Type: complete

Annotations of Ll_transcript_490974

• Blastp: Soluble inorganic pyrophosphatase 3 from Arabidopsis with 91.25% of identity
• Blastx: Soluble inorganic pyrophosphatase 4 from Arabidopsis with 91.25% of identity
• Eggnog: Pyrophosphate phospho-hydrolase(COG0221)
• Kegg: Link to kegg annotations (AT2G46860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013468323.1)
• Pfam: Inorganic pyrophosphatase (PF00719.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;