Protein coding transcript 865

• Transcript: Ll_transcript_277606
• CDS coordinates: 2-472 (+)
• Peptide sequence: KNLPSYPTKQQFLAYLKSYAEHFDIKPAFSNTVVSAEFDQRCGYWRVKCERVKKEEEIEYVCRWLIVASGENAVEVVPQIEGMGDFEGPIMHTSSYKSGSMFCGKKVLVIGCGNSGMEVCLDLCNHNAQPSLVVRDTVHILPQQMFGKSTFGLSMSL
• ORF Type: internal

Annotations of Ll_transcript_277606

• Blastp: Indole-3-pyruvate monooxygenase YUCCA2 from Arabidopsis with 69.48% of identity
• Blastx: Indole-3-pyruvate monooxygenase YUCCA2 from Arabidopsis with 69.48% of identity
• Eggnog: Monooxygenase(COG2072)
• Kegg: Link to kegg annotations (AT4G13260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446326.1)
• Pfam: Flavin-binding monooxygenase-like (PF00743.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;