Protein coding transcript 86569

• Transcript: Ll_transcript_490736
• CDS coordinates: 959-1351 (+)
• Peptide sequence: MKKAIGQTVRDLKRGVNKKVLKVPGIEQKVLDATSNEAWGPHGSLLADIAQASRNYHEYQIIMAVIWKRINDTGKNWRHVYKALTVLEYLVGHGSERVIEEIKEHAYQISWKRPGKQCQEEIRESRYPRE*
• ORF Type: complete

Annotations of Ll_transcript_490736

• Blastp: Clathrin interactor EPSIN 3 from Arabidopsis with 89.09% of identity
• Blastx: Clathrin interactor EPSIN 2 from Arabidopsis with 87.27% of identity
• Eggnog: Clathrin interactor 1(ENOG410XSM0)
• Kegg: Link to kegg annotations (AT3G59290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428520.1)
• Pfam: ENTH domain (PF01417.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;