Protein coding transcript 86572

• Transcript: Ll_transcript_490738
• CDS coordinates: 1759-2748 (+)
• Peptide sequence: MPRPGDRYDDDRYGSREEDRSGSGYGREREWGSRDGDQYSREGDRYGRDYEERSSRDGYRDDEYSGRNQSVDDYQYGSRSRSSDGDHDRGYDDDVQRSSRGSSAKAENRSLEGRLEQKLTEQNVGAPPSYEEVVGESRSPIHNERDGETSAASAPKGSSPVSDNPHQPPAPTGSSPHMKDDPTKATAAAATGTATSGNQKVEAFDEFDPRGPPSAVPATATNAEIDLFGTLSESFTLNSLALVPSSQATTTPEGNANLDPTASFAAAPSASNNFNKSFEDPFGDTPFEAIPSAETAPSQPQIHQSLEPSQSSGPNVEAVSNFGFGESFSV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_490738

• Blastp: Clathrin interactor EPSIN 3 from Arabidopsis with 45.63% of identity
• Blastx: Clathrin interactor EPSIN 3 from Arabidopsis with 47.68% of identity
• Eggnog: Clathrin interactor 1(ENOG410XSM0)
• Kegg: Link to kegg annotations (AT3G59290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452523.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;