Protein coding transcript 86577

• Transcript: Ll_transcript_490718
• CDS coordinates: 218-1051 (+)
• Peptide sequence: MKKAIGQTVRDLKRGVNKKVLKVPGIEQKVLDATSNEAWGPHGSLLADIAQASRNYHEYQIIMAVIWKRINDTGKNWRHVYKALTVLEYLVGHGSERVIEEIKEHAYQISTLSNFQYVDSSGRDQGNNVRKKSESLVILVNDKERIIEVRQKAAANRDKFHNNSAGGIPRPGSYSSSGAYGDRYDNDSYGSREEDRSGSGYGREREWGSRDGDRYSRDGDRYGRDYEEHPSKDGYRNDEYSGRNQSFEDDQYGSRSRSSDRDHDRGYDDDGQHSSRGS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_490718

• Blastp: Clathrin interactor EPSIN 2 from Arabidopsis with 71.94% of identity
• Blastx: Clathrin interactor EPSIN 2 from Arabidopsis with 73.79% of identity
• Eggnog: Clathrin interactor 1(ENOG410XSM0)
• Kegg: Link to kegg annotations (AT2G43160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428520.1)
• Pfam: ENTH domain (PF01417.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;