Protein coding transcript 86578

• Transcript: Ll_transcript_490720
• CDS coordinates: 1-753 (+)
• Peptide sequence: DATSNEPWGPHGTLLADIAQATRNPHEYQMITAVIWKRINDTGKNWRHVYKALTVLEYLVANGSERVIDEIREHAYQISTLSDFHYIDSSGRDQGHNVRKKSQSLVVLVNDKERIFEVRQKAAANRDKFRNNPSGGMHRPDSYSNSAYGDRYDDRHGSREEDRNDYGYGREREGGYRDDDRSSRDGDRYNRDYEERYGRGGYRDDDSRGRSRSVDYQNESRSRSSDRDRDRSYEDDGHSSRYESIDSVYQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_490720

• Blastp: Clathrin interactor EPSIN 2 from Arabidopsis with 37.85% of identity
• Blastx: Clathrin interactor EPSIN 2 from Arabidopsis with 76.54% of identity
• Eggnog: Clathrin interactor 1(ENOG410XSM0)
• Kegg: Link to kegg annotations (AT2G43160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455964.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;