Protein coding transcript 86585

• Transcript: Ll_transcript_490090
• CDS coordinates: 317-907 (+)
• Peptide sequence: MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSIVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLLSRASYENISKKWIPELRHYAPTVPIVLVGTKLDLREDRQYLIDHPQATPITTAQGEELKKAIGAAVYLECSSKTQQNVKAVFDAAIKVVLQPPKPKKKRKKTRSCFFL*
• ORF Type: complete

Annotations of Ll_transcript_490090

• Blastp: Rac-like GTP-binding protein RAC2 from Lotus with 97.96% of identity
• Blastx: Rac-like GTP-binding protein RAC2 from Lotus with 97.96% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432137.1)
• Pfam: Ras family (PF00071.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;