Transcript | Ll_transcript_490440 |
---|---|
CDS coordinates | 186-845 (+) |
Peptide sequence | MGNSIGRSKKAKVMKIDGETFKVKTPAIANDVVKDHPGHVLLDSQAVKHFGLRAKPLQPHQELKPKNIYFLVELPKIQTEEGDDNKGTLHRRVRSSGISRMNAKERLDLLMLSKRSVSDFGVVREPPLNNMSVDHGPMRVKMRIPKAQLEKMMEESNNDGAEVAEKIMSLYMRTNGDGAAVEDGGVNVAHKLNSKRRVKQVSFSPMEDSGEIHVEAASQ* |
ORF Type | complete |
Blastp | Uncharacterized protein At1g66480 from Arabidopsis with 54.8% of identity |
---|---|
Blastx | Uncharacterized protein At1g66480 from Arabidopsis with 54.8% of identity |
Eggnog | NA(ENOG41117UA) |
Kegg | Link to kegg annotations (AT1G66480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459074.1) |
Pfam | Domain of unknown function (DUF4228) (PF14009.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer