Transcript | Ll_transcript_488836 |
---|---|
CDS coordinates | 604-1440 (+) |
Peptide sequence | MSRWASDGLSPRGADDKSKGLKVISSPEIGEFQTELSESTITRSSGTGGRDHYLGRSVDDTDSEKDFPTDSRDDAGEQSDLSDSPSDSDDDSGLVHVQTNRNMFQSCRSICEYEMIKKINEGTYGVVYKARDKKTGEVVAIKKVKMNISRDGFPLSALREMNILLSFDHPSIVDVKEVAVDDYDGTFMVMEYMEHDLKELMKAKKHHFSISEIKSMMKQLLEGVKYIHDNWVIHRDLKTSNILLNNEGHLKICDFGLSRQYGSPLKPYTPVVVTLWYR* |
ORF Type | complete |
Blastp | Cyclin-dependent kinase G-2 from Oryza sativa with 74.72% of identity |
---|---|
Blastx | Cyclin-dependent kinase G-2 from Oryza sativa with 43.43% of identity |
Eggnog | Cyclin-dependent kinase(ENOG410XQ50) |
Kegg | Link to kegg annotations (4336224) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463064.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer