| Transcript | Ll_transcript_490108 |
|---|---|
| CDS coordinates | 127-660 (+) |
| Peptide sequence | MPLPIKSMRPAHGGGGKDFDDVPPSNNLWVGNLAPSVTDSDLMNLFAQYGALDSVTSYSSRSYAFVFFKRVEDAKSAKNNLQGFALRGNYLKIEFARPVCALFLDFNGFCIFYPYSYGCRYKLYRIISLQSLSLQFGLQNCSIRLLIYFYNPYFQHLSYFSSLCMRLIRISVCVAGN* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Flowering time control protein FPA from Arabidopsis with 55.41% of identity |
| Eggnog | Rna-binding protein(COG0724) |
| Kegg | Link to kegg annotations (AT2G43410) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019413411.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer