Transcript | Ll_transcript_489754 |
---|---|
CDS coordinates | 59-1177 (+) |
Peptide sequence | MAKKEEYLPLYEKVCLKRTYNRVLDSFILLLLFLLLCYRLISIKNTFTIPYFLAFLSESWFTFTWIVILNTKWNASATKTHLQLLLQRVPDLPAVDLFVTTADPILEPPIITVNTVLSLLALDYPANKLACYVSDDGCSPLNFYALFEASKFAMLWVPFCKKYNVQLRAPFRYFSEPANTISEGDSLQFKQQWLQMKDLYDNLSRKIEDVTREPILLPHDGEFTVFSNTHPRNHPSIIKVILENKESVCDEVPHLIYISREKRPNHPHQYKAGAMNVLTRVSGLMTNAPFMLNVDCDMVVNNPKIVQHAMCILMDPKKGKEVAFVQCFQQFYDGIKDDPFGNQWVSAFEVCFHFQNKVLSLLYSFSFMFIGT* |
ORF Type | complete |
Blastp | Cellulose synthase-like protein B6 from Arabidopsis with 55.39% of identity |
---|---|
Blastx | Cellulose synthase-like protein B3 from Arabidopsis with 53.15% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT4G15320) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447721.1) |
Pfam | Cellulose synthase (PF03552.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer