| Transcript | Ll_transcript_488581 |
|---|---|
| CDS coordinates | 60-485 (+) |
| Peptide sequence | MDATATAPAATPDSATTDDQNPSAAITRWKFEVSRQYQHLLDKTTPFVLYRWIGFFVIALIYVVRVYFVEGFYVVSYGLGIYILNLLIGFLSPQVDPEVLELSEGPTLPTRGSDEFRPFVRRLPEFKFWYISVFSFIDFLN* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Protein RER1A from Arabidopsis with 67.92% of identity |
| Eggnog | RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae)(COG5249) |
| Kegg | Link to kegg annotations (AT4G39220) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019446804.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer