Transcript | Ll_transcript_488603 |
---|---|
CDS coordinates | 60-485 (+) |
Peptide sequence | MDATATAPAATPDSATTDDQNPSAAITRWKFEVSRQYQHLLDKTTPFVLYRWIGFFVIALIYVVRVYFVEGFYVVSYGLGIYILNLLIGFLSPQVDPEVLELSEGPTLPTRGSDEFRPFVRRLPEFKFWYISVFSFIDFLN* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | Protein RER1A from Arabidopsis with 67.92% of identity |
Eggnog | RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae)(COG5249) |
Kegg | Link to kegg annotations (AT4G39220) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446804.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer