Protein coding transcript 86960

• Transcript: Ll_transcript_490380
• CDS coordinates: 414-1427 (+)
• Peptide sequence: MYKDKYMGHGGGFPPPSGCFSGYSPNESAAFNVKSEPASSSSSFPPLVVPGTGADSSQFGHGMSTESSGFSHDISRMSDNPMKNRGHRRAHSEILTLPDDVSFGSDLGVVGGADGPSFSDDTEEDLLSMYLDMDKVNSTSATSTFQFSEPSNAAATSGSGPTSAPASGAHTSSAENIVTGTNERPRIRHQHSQSMDGSTTIKPEMLVSGSSDDISAVDSKKAMSAAKLAELALIDPKRAKRIWANRQSAARSKERKMRYIGELERKVQTLQTETTSMSAQLTLLQRDTNGLNSENSELKLRLQTMEQQVRLQDALNDALKEEIQHLKILTGQAMPPNG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_490380

• Blastp: Probable transcription factor PosF21 from Arabidopsis with 64.16% of identity
• Blastx: Probable transcription factor PosF21 from Arabidopsis with 68.65% of identity
• Eggnog: Transcription factor(ENOG4111FX9)
• Kegg: Link to kegg annotations (AT2G31370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436537.1)
• Pfam: Basic region leucine zipper (PF07716.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;