Protein coding transcript 86967

• Transcript: Ll_transcript_490388
• CDS coordinates: 400-1272 (+)
• Peptide sequence: MDKDKSPGHGGGFPPPSPRYSGFSPAAAPFNVRSEPSSSYPPLVDSASASFIHDISRMPDNPPRNRGHRRAHSEIITLTDDLSFDSDLGVVGGADGPSFSDETEEDLLSMYLDMDKFISSSATSPFQIGEPSTAAAAPTSRAPASSADDLVVGTNQRPRVRHQHSQSMDGSTTIKPEMLVSGSEDISGADAKKSLSAAKLAELALVDPKRAKRIWANRQSAARSKERKMRYISELERKVQTLQTEAISSSAQLTLLQRDTTGVSTENSELKLRLQTMEQQVHLQDGKLLL*
• ORF Type: complete

Annotations of Ll_transcript_490388

• Blastp: Probable transcription factor PosF21 from Arabidopsis with 66.78% of identity
• Blastx: Probable transcription factor PosF21 from Arabidopsis with 72.8% of identity
• Eggnog: Transcription factor(ENOG4111FX9)
• Kegg: Link to kegg annotations (AT2G31370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413061.1)
• Pfam: Basic region leucine zipper (PF07716.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;