Protein coding transcript 87002

• Transcript: Ll_transcript_490401
• CDS coordinates: 111-461 (+)
• Peptide sequence: MGSSSLHSDGNQVKKVLGLGYWVQGFRCFPWLAVIFFLKDGLSVDPSTLQILQNSANLPMVGKPLYGLLSDSIYIFGQHRLPYIALGAFLQALSWLVIANSPSTISIFTLYIPPPR*
• ORF Type: complete

Annotations of Ll_transcript_490401

• Blastp: Probable folate-biopterin transporter 7 from Arabidopsis with 63.11% of identity
• Blastx: Probable folate-biopterin transporter 7 from Arabidopsis with 46.37% of identity
• Eggnog: BT1 family(ENOG410XRKZ)
• Kegg: Link to kegg annotations (AT1G64890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420127.1)
• Pfam: BT1 family (PF03092.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;