Protein coding transcript 87194

• Transcript: Ll_transcript_490312
• CDS coordinates: 3-395 (+)
• Peptide sequence: VIHRDIRSSNVLIFEDYKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAA
• ORF Type: internal

Annotations of Ll_transcript_490312

• Blastp: PTI1-like tyrosine-protein kinase 2 from Arabidopsis with 96.69% of identity
• Blastx: PTI1-like tyrosine-protein kinase 2 from Arabidopsis with 96.69% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G30740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014514378.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;