Transcript | Ll_transcript_490339 |
---|---|
CDS coordinates | 220-753 (+) |
Peptide sequence | MSCFNCCEEDEYNKAAESGGPYVVKNAAGNDGNYHASETAKQGAQTVKVQPIEVPSIPADELKEVTDNFGQDSLIGEGSYGRVYYGILKSGQAAAIKKLDSSKQPDQEFLAQVSMVSRLKHENFVQLLGYCVDGNSRILAYEFASNGSLHDILHGIWLNEKYTNVYNRIEIFLCYRN* |
ORF Type | complete |
Blastp | Pto-interacting protein 1 from Lycopersicon with 69.03% of identity |
---|---|
Blastx | Probable receptor-like protein kinase At2g47060 from Arabidopsis with 94.38% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (544006) |
CantataDB | Link to cantataDB annotations (CNT0002382) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428630.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer