Protein coding transcript 87208

• Transcript: Ll_transcript_490309
• CDS coordinates: 2-325 (+)
• Peptide sequence: AKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVKQCIDERLGEEYPPKAVAKMAAVAALCVQYEADFRPNMSIVVKALQPLLTARLGPAGETPN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_490309

• Blastp: Probable receptor-like protein kinase At2g47060 from Arabidopsis with 89.42% of identity
• Blastx: Probable receptor-like protein kinase At2g47060 from Arabidopsis with 89.42% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT2G47060)
• CantataDB: Link to cantataDB annotations (CNT0002382)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020226559.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;