Protein coding transcript 87209

• Transcript: Ll_transcript_490317
• CDS coordinates: 1258-1791 (+)
• Peptide sequence: MSCFNCCEEDEYNKAAESGGPYVVKNAAGNDGNYHASETAKQGAQTVKVQPIEVPSIPADELKEVTDNFGQDSLIGEGSYGRVYYGILKSGQAAAIKKLDSSKQPDQEFLAQVSMVSRLKHENFVQLLGYCVDGNSRILAYEFASNGSLHDILHGIWLNEKYTNVYNRIEIFLCYRN*
• ORF Type: complete

Annotations of Ll_transcript_490317

• Blastp: Pto-interacting protein 1 from Lycopersicon with 69.03% of identity
• Blastx: Probable receptor-like protein kinase At2g47060 from Arabidopsis with 94.38% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (544006)
• CantataDB: Link to cantataDB annotations (CNT0002382)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428630.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;