Protein coding transcript 87210

• Transcript: Ll_transcript_490320
• CDS coordinates: 300-659 (+)
• Peptide sequence: MSCFSCCEDDEYHKAAESGGPYIVKNAPGNDGNYHASESAKQGAQTVKVQPIEVPSIPVDELKEVTDNFGQDSLIGEGSYGRVYYGILKSEQAAAIKKLDSSKQPDQEFLAQVCMTTVV*
• ORF Type: complete

Annotations of Ll_transcript_490320

• Blastp: Probable receptor-like protein kinase At2g47060 from Arabidopsis with 93.94% of identity
• Blastx: Pto-interacting protein 1 from Lycopersicon with 76.25% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT2G47060)
• CantataDB: Link to cantataDB annotations (CNT0002382)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453214.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;