| Transcript | Ll_transcript_489498 |
|---|---|
| CDS coordinates | 1-390 (+) |
| Peptide sequence | FKIFGSICYKHTPEARRRKLDNRSERLIFLGYHSIGSYKVFNPIDNNFSFSRDVVFDETDAWAWNTKPVVSSKPGLMHIEGTSATPNLTSPETEGAETVIDNAGQATNDSGARPQRQRQLPPRLRDYELF |
| ORF Type | internal |
| Blastp | Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 28.68% of identity |
|---|---|
| Blastx | Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 38.1% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019465092.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer