Protein coding transcript 87252

• Transcript: Ll_transcript_489725
• CDS coordinates: 3166-3771 (+)
• Peptide sequence: MTRLNEGLSLFDAILIVPMFQITWTLFSICTGFIYFQEYQVFDAVRTTMFILGMMCVFIGISLLAPDESKVSGADTKDSSSDSLVSPAISTEMNRLEVSSHDAHHKDTRSFVKGLLMKITDMLVKAKNSCALHLGFGEDTINASSVLVMPMMSSRMNGFRGSGLERARILSMRNASGWSKIPVDEDVGKLIETSPLVPPSP*
• ORF Type: complete

Annotations of Ll_transcript_489725

• Blastp: Probable magnesium transporter NIPA8 from Arabidopsis with 64.97% of identity
• Blastx: Probable magnesium transporter NIPA8 from Arabidopsis with 53.35% of identity
• Eggnog: NIPA-like domain containing(ENOG410XNR8)
• Kegg: Link to kegg annotations (AT3G26670)
• CantataDB: Link to cantataDB annotations (CNT0000892)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453111.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;