Protein coding transcript 87253

• Transcript: Ll_transcript_489726
• CDS coordinates: 739-1311 (+)
• Peptide sequence: MGEWIVGALINLIGSIIINFGTNLLKLGHNERERQLLGSDGLNGKMPPKPIASFQTWRVGIVFFFLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLHKMVAVKVLVATAFIVLGNTFLVAFGNHQSPVYTPEQLEEKYTNTAFLLYLLALILIVAVHHSIYKRGELQLAVSGHDLRPYWNTLLPF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_489726

• Blastp: Probable magnesium transporter NIPA8 from Arabidopsis with 72.77% of identity
• Blastx: Probable magnesium transporter NIPA8 from Arabidopsis with 72.77% of identity
• Eggnog: NIPA-like domain containing(ENOG410XNR8)
• Kegg: Link to kegg annotations (AT3G26670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453109.1)
• Pfam: Magnesium transporter NIPA (PF05653.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;