Transcript | Ll_transcript_489714 |
---|---|
CDS coordinates | 484-999 (+) |
Peptide sequence | MGEWIVGALINLSGSIIINFGTNLLKLGHNERERHVLGNDGLNGKIPPKPIICFQTWRVGIVLFFLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLHKMVAVKVLVATAFIVLGNTFLVAFGNHQSPVYTPEQLAEKYTNSAFLLYLLALIFIVALHHTIYKRGEL |
ORF Type | 3prime_partial |
Blastp | Probable magnesium transporter NIPA8 from Arabidopsis with 76.16% of identity |
---|---|
Blastx | Probable magnesium transporter NIPA8 from Arabidopsis with 76.16% of identity |
Eggnog | NIPA-like domain containing(ENOG410XNR8) |
Kegg | Link to kegg annotations (AT3G26670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427596.1) |
Pfam | Magnesium transporter NIPA (PF05653.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer