Transcript | Ll_transcript_489715 |
---|---|
CDS coordinates | 3083-3688 (+) |
Peptide sequence | MTRLNEGLSLFDAILIVPMFQITWTLFSICTGFIYFQEYQVFDAVRTTMFILGMMCVFIGISLLAPDESKVSGADTKDSSSDSLVSPAISTEMNRLEVSSHDAHHKDTRSFVKGLLMKITDMLVKAKNSCALHLGFGEDTINASSVLVMPMMSSRMNGFRGSGLERARILSMRNASGWSKIPVDEDVGKLIETSPLVPPSP* |
ORF Type | complete |
Blastp | Probable magnesium transporter NIPA8 from Arabidopsis with 64.97% of identity |
---|---|
Blastx | Probable magnesium transporter NIPA8 from Arabidopsis with 53.05% of identity |
Eggnog | NIPA-like domain containing(ENOG410XNR8) |
Kegg | Link to kegg annotations (AT3G26670) |
CantataDB | Link to cantataDB annotations (CNT0000892) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453111.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer