Transcript | Ll_transcript_293659 |
---|---|
CDS coordinates | 3-413 (+) |
Peptide sequence | IIVARIKKMPLMKEMELQENGSIKSENEHKSLIIDIEAMVESVELPLVSHCCIYKVPQKIRKLNEQVYTPSIVSIGPFHNGDKRLESMEDLKLRYVKSFLERTPKGLQDCIEYIKKSDVVIQRPFNKAVMILSESF* |
ORF Type | 5prime_partial |
Blastp | UPF0481 protein At3g47200 from Arabidopsis with 41.82% of identity |
---|---|
Blastx | UPF0481 protein At3g47200 from Arabidopsis with 35.19% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT3G47200) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431027.1) |
Pfam | Plant protein of unknown function (PF03140.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer