Transcript | Ll_transcript_489224 |
---|---|
CDS coordinates | 3-527 (+) |
Peptide sequence | QLIACASNIYYINDKLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLGMTTYTAWYMAIAALLHGQVENVSHSGPKKLVLYFTGATNILYTFGGHAVTVEIMHAMWKPQKFKYIYLMATLYVFTLTLPSSSAVYWAFGDELLNHSNAFSLLPKNGFRDAAVILMLIHQFITFG |
ORF Type | internal |
Blastp | Auxin transporter-like protein 4 from Medicago with 93.71% of identity |
---|---|
Blastx | Auxin transporter-like protein 4 from Medicago with 93.71% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (MTR_4g415390) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450308.1) |
Pfam | Transmembrane amino acid transporter protein (PF01490.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer