Transcript | Ll_transcript_489061 |
---|---|
CDS coordinates | 1167-1469 (+) |
Peptide sequence | MRSALIDIIQTRGFQGLYAGLSPTLVEIVPYAGLQFGTYDTFKRWAMAWNHFRYSNTIADDSLSSFQLFICGLAAGTCAKLVCHPLDVVKKRFQVTSARF* |
ORF Type | complete |
Blastp | Mitochondrial thiamine diphosphate carrier 2 from Arabidopsis with 74.49% of identity |
---|---|
Blastx | Mitochondrial thiamine diphosphate carrier 2 from Arabidopsis with 74.51% of identity |
Eggnog | Solute carrier family 25(ENOG410ZRF1) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450973.1) |
Pfam | Mitochondrial carrier protein (PF00153.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer