Protein coding transcript 87350

• Transcript: Ll_transcript_489065
• CDS coordinates: 1-633 (+)
• Peptide sequence: RDLVTPSKYTGMIQASRDIFREEGVRGFWRGNVPALLMVMPYTAIQFTVLHKIKTLASGSSDTEDHVGLSPYLSYVSGALAGCAATLGSYPFDLIRTILASQGEPKVYPNMRSALIDIIQTRGFQGLYAGLSPTLVEIVPYAGLQFGTYDTFKRWAMAWNHFRYSNTIADDSLSSFQLFICGLAAGTCAKLVCHPLDVVKKRFQVTSARF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_489065

• Blastp: Mitochondrial thiamine diphosphate carrier 2 from Arabidopsis with 78.74% of identity
• Blastx: Mitochondrial thiamine diphosphate carrier 2 from Arabidopsis with 78.74% of identity
• Eggnog: Solute carrier family 25(ENOG410ZRF1)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450973.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;