Protein coding transcript 87406

• Transcript: Ll_transcript_490838
• CDS coordinates: 3-320 (+)
• Peptide sequence: FLRDRAQVEQLLRYVIEEPPEDAEHKRVFKFPFISCEIFTCEIDVILKTLVDEEELMNLLFSFLEPDRSHSSLLAGYFSKVVVCLMMRKTVPLMNYVQVSKARCF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_490838

• Blastp: Serine/threonine-protein phosphatase 6 regulatory subunit 2 from Mus with 35.71% of identity
• Blastx: Serine/threonine-protein phosphatase 6 regulatory subunit 2 from Mus with 35.71% of identity
• Eggnog: Protein phosphatase 6, regulatory subunit(ENOG410XRM1)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020215332.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;