Protein coding transcript 8743

• Transcript: Ll_transcript_504470
• CDS coordinates: 1401-1784 (+)
• Peptide sequence: MLDDDKGDFVGTAVREVEEETGIKLSLEDMIDLTAFLDSSTGRRVIPSPGGCDEELSIFLYRGRVDKEIITQLQGKQTGLIKHGELIKVHVVPYKKLWRTTADSKVLMAIALLEMAMKEGLLPPFAT*
• ORF Type: complete

Annotations of Ll_transcript_504470

• Blastp: Nudix hydrolase 14, chloroplastic from Arabidopsis with 74.59% of identity
• Blastx: Nudix hydrolase 14, chloroplastic from Arabidopsis with 77.98% of identity
• Eggnog: Nudix hydrolase(COG0494)
• Kegg: Link to kegg annotations (AT4G11980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446628.1)
• Pfam: NUDIX domain (PF00293.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;