Protein coding transcript 8747

• Transcript: Ll_transcript_504475
• CDS coordinates: 232-642 (+)
• Peptide sequence: MAIAIRSISLALKRFSQVQPPNPVRKNKAFFCKMSNESTPLTHSITLPSQPSQPVHVVASPGVSHSDFWSAIGSSLFKQWLHNLETETGILTDGTMTLRQVLIQGVDMFGRRIGFLKFKADIIDKGTGNKVRNNLH*
• ORF Type: complete

Annotations of Ll_transcript_504475

• Blastp: Nudix hydrolase 14, chloroplastic from Arabidopsis with 72% of identity
• Blastx: Nudix hydrolase 14, chloroplastic from Arabidopsis with 85.26% of identity
• Eggnog: Nudix hydrolase(COG0494)
• Kegg: Link to kegg annotations (AT4G11980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446628.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;