Transcript | Ll_transcript_504476 |
---|---|
CDS coordinates | 232-633 (+) |
Peptide sequence | MAIAIRSISLALKRFSQVQPPNPVRKNKAFFCKMSNESTPLTHSITLPSQPSQPVHVVASPGVSHSDFWSAIGSSLFKQWLHNLETETGILTDGTMTLRQVLIQVSKFTLFIFKKSDEGCFFFLQERGYFCVT* |
ORF Type | complete |
Blastp | Nudix hydrolase 14, chloroplastic from Arabidopsis with 67.12% of identity |
---|---|
Blastx | Nudix hydrolase 14, chloroplastic from Arabidopsis with 90.48% of identity |
Eggnog | Nudix hydrolase(COG0494) |
Kegg | Link to kegg annotations (AT4G11980) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446628.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer