Protein coding transcript 875

• Transcript: Ll_transcript_432999
• CDS coordinates: 2-397 (+)
• Peptide sequence: SDLEKRVGMVLEDAEVNDLLIPRYQNGDQGKMANMPNSFEEFTMQDIDVVQRIVEYFLMHEQQQMQLQQNHGKFNISRLLDNYLAEIARDPNLSITKFQVLAELLPENARSCDDGIYRAIDTYLKVIQLLVI
• ORF Type: internal

Annotations of Ll_transcript_432999

• Blastp: BTB/POZ domain-containing protein DOT3 from Arabidopsis with 57.94% of identity
• Blastx: BTB/POZ domain-containing protein DOT3 from Arabidopsis with 57.94% of identity
• Eggnog: BTB POZ domain-containing protein DOT3-like(ENOG41113GE)
• Kegg: Link to kegg annotations (AT5G10250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462185.1)
• Pfam: NPH3 family (PF03000.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;