Protein coding transcript 87529

• Transcript: Ll_transcript_489611
• CDS coordinates: 1-345 (+)
• Peptide sequence: KDAIEGLNGQDLDGRNITVNEAQSRGSGGGGGRGGGGYGGGGGGCRSGGGGGYGGGRREGGGGGYNRNGGGGGYGGGGGGGGYGGGRDRGYGGGGDGGSRYSRDGESGGGGWRN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_489611

• Blastp: Glycine-rich RNA-binding protein blt801 from Hordeum with 81.48% of identity
• Blastx: Glycine-rich RNA-binding protein 3 from Populus with 95.65% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000217)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448500.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;