| Transcript | Ll_transcript_489509 |
|---|---|
| CDS coordinates | 175-498 (+) |
| Peptide sequence | MSKRPTPDPVAVLRGHRASVTDVSFHPSNPILFSCSSDGEVRIWDTLQHRTLFSSWLHSAAHGIVSVATTPSLPTNQFLSQGRDGTVKLWDFNDAGLSRYTPIFLEF* |
| ORF Type | complete |
| Blastp | Protein DECREASED SIZE EXCLUSION LIMIT 1 from Nicotiana with 55.05% of identity |
|---|---|
| Blastx | Protein DECREASED SIZE EXCLUSION LIMIT 1 from Nicotiana with 54.31% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | Link to cantataDB annotations (CNT0001698) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019416003.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer