Transcript | Ll_transcript_489509 |
---|---|
CDS coordinates | 175-498 (+) |
Peptide sequence | MSKRPTPDPVAVLRGHRASVTDVSFHPSNPILFSCSSDGEVRIWDTLQHRTLFSSWLHSAAHGIVSVATTPSLPTNQFLSQGRDGTVKLWDFNDAGLSRYTPIFLEF* |
ORF Type | complete |
Blastp | Protein DECREASED SIZE EXCLUSION LIMIT 1 from Nicotiana with 55.05% of identity |
---|---|
Blastx | Protein DECREASED SIZE EXCLUSION LIMIT 1 from Nicotiana with 54.31% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0001698) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416003.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer