Transcript | Ll_transcript_489554 |
---|---|
CDS coordinates | 175-1071 (+) |
Peptide sequence | MSKRPTPDPVAVLRGHRASVTDVSFHPSNPILFSCSSDGEVRIWDTLQHRTLFSSWLHSAAHGIVSVATTPSLPTNQFLSQGRDGTVKLWDFNDAGLSRIPLLTIETNTYHFCKLSTVKTPSVLSKSGKESEFRRTPNGEIPEDKKEKAYDDQPCFESREDNMHHEGLPYVALSGENSSQVEIWDLKSAERFVQLPSNITSNSSSVCNKDRGMCMALQLFSPSESRGFLNVLAGYEDGSMLWWDVRNPRVPLTSVKFHSEPVLSICIDGSCNGGISGAADDKIVMYSLEHSTVTSFTF* |
ORF Type | complete |
Blastp | Protein DECREASED SIZE EXCLUSION LIMIT 1 from Nicotiana with 59.32% of identity |
---|---|
Blastx | Protein DECREASED SIZE EXCLUSION LIMIT 1 from Nicotiana with 59.18% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0001698) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416003.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer