Transcript | Ll_transcript_489517 |
---|---|
CDS coordinates | 657-1316 (+) |
Peptide sequence | MHHEGLPYVALSGENSSQVEIWDLKSAERFVQLPSNITSNSSSVCNKDRGMCMALQLFSPSESRGFLNVLAGYEDGSMLWWDVRNPRVPLTSVKFHSEPVLSICIDGSCNGGISGAADDKIVMYSLEHSTGTCVFKKEISLERPGISGSSIRPDGKIAATAGWDHRIRIYNYRKGNALAILKYHRATCNAVTYSPDCKLMASASEDTNVGLWDLYPPQL* |
ORF Type | complete |
Blastp | Protein DECREASED SIZE EXCLUSION LIMIT 1 from Arabidopsis with 70.05% of identity |
---|---|
Blastx | Protein DECREASED SIZE EXCLUSION LIMIT 1 from Nicotiana with 61.49% of identity |
Eggnog | wd repeat(COG2319) |
Kegg | Link to kegg annotations (AT4G29860) |
CantataDB | Link to cantataDB annotations (CNT0001698) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416003.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer