Protein coding transcript 87722

• Transcript: Ll_transcript_489600
• CDS coordinates: 1-429 (+)
• Peptide sequence: YAHNNITHRLEPDGSVYNYASESKGAKVVAHNKEAKGAKNILGKDHDKYLRNPCSVGGKFVVIELAEETLVDSVKIANFEHYSSNFKEFELGGSLSYPTEAWTTLGNFIAANVKHAQIFKLSEPKWVRYLKLSLLSHYGSEFY
• ORF Type: internal

Annotations of Ll_transcript_489600

• Blastp: SUN domain-containing protein 5 from Arabidopsis with 73.94% of identity
• Blastx: SUN domain-containing protein 5 from Arabidopsis with 73.94% of identity
• Eggnog: SUN domain containing ossification factor(ENOG41116S0)
• Kegg: Link to kegg annotations (AT4G23950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423360.1)
• Pfam: Sad1 / UNC-like C-terminal (PF07738.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;